<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
01PB18ZA 01PB18ZA South Africa 2001 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, P39Q, R41K, L63P, H69K, L89I  
>01PB18ZA| codons 2-99
QITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLQGKWKPKMIGGIGGFIKVRQYDQ
IPIEICGKKAIGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, E40D, S48T, V60I, K102Q, V118I, K122E, I135T, E138A, K173A, Q174N, D177E, T200A, Q207E, V245Q, A272P, K277R, T286A, E291D, V292I, I293V  
>01PB18ZA| codons 9-317
PVKLKPGMDGPKVKQWPLTEEKIKALTAICEDMEKEGKITKIGPENPYNTPIFAIKKKDS
TKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSIPLDEDFRKYT
AFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRANNPEIVIYQYMDDLY
VGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPE
KDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAELELAENRE
ILKEPVHGV

References
Author Title Citation
Bessong, PO Characterization of human immunodeficiency virus type 1 from a previously unexplored region of South Africa with a high HIV prevalence. ARHR, 2005