<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA23800 CA55226 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 22
2 3TC+AZT+IDV 78
3 3TC+D4T+NFV 96
4 ABC+APV+EFV+RTV 52
5 3TC+ABC+AZT+LPV 13
6 3TC+ABC+AZT 85
7 3TC+ABC+AZT+EFV 24
8 3TC+AZT+EFV+TDF 57
9 ATV+D4T+RTV+TDF 23

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219E L100I, K103N   V90I, D123E, S162D, D177E, Q207E, R211K, L228HR, A272P, K277R, L283I, R284K, I293V, E297K  
>CA55226| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFFTPDEKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIKGTKALTEVVPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I50L, V82T, L90M   L10R, N37H, R41K, L63P, A71I, I72V, V77I, I93L  
>CA55225| codons 1-99
PQITLWQRPRVTIKIGGQLKEALLDTGADDTILEEMHLPGKWKPKIVGGLGGFIKVRQYD
QIPIEICGHKIVGTVLIGPTPTNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009