<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1329 CA55164 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ IDV 21
2 3TC+ D4T+ NFV 57
3 SQV+ 3TC+ AZT+ RTV 41
4 3TC+ AZT+ EFV+ SQV 20
5 Unknown 286

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V   K103N P225H V35R, T39A, K102Q, D123E, I135T, I142V, S162C, T200A, V245T, A272P, I293V, E297K  
>CA55164| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALREICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEHPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I84V, L90M L10F, L33F, K43T, N88D I15V, E35D, M36L, N37E, D60E, I62V, L63P, I93L  
>CA55163| codons 1-99
PQITLWQRPFVTIKVGGQLKEALLDTGADNTVFEDLELPGRWTPKMIGGIGGFIKVRQYE
QVPIEICGHKAIGTVLVGPTPVNVIGRDLMTQLGCTLNF

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012