<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14481 CA55141 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NFV 78
2 None 78
3 ABC+DDI+NVP 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D L10V, I13V, E35D, M36I, R41K, I62IV, L63P, K70KR, A71V, I93L  
>CA55141| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADNTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHRVIGTVLVGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, Y115F, M184V   K103N, Y181C   K20R, V35I, T69TN, K173E, T200A, Q207E, F214FL, H221HY, Q278H, T286A, V292VI, I293V, E297K, G333E, G359S  
>CA55142| codons 1-368
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAFFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDIVI
CQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGLTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGAKALTEIVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEQGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQL

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009