<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9956 CA55121 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 13
2 DDI 30
3 3TC+D4T 48
4 3TC+D4T+DDC+NFV 13
5 3TC+AZT+NVP 13
6 3TC+AZT+SQV 204
7 3TC+AZT+LPV+NVP 160

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54T, V82A, L90M   L10V, L19I, K20R, E35D, M36I, N37D, R41K, L63P, I64V, A71V, I93L  
>CA55121| codons 1-99
PQITLWQRPVVTIKIGGQIREALLDTGADDTVLEDIDLPGKWKPKMIVGIGGFTKVRQYD
QIPVEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   P4S, E28G, S48ST, K122P, I135L, R211K, F214L, A272P, V276I, K277R, T286A, P294Q, E297K  
>CA55122| codons 1-300
PISSIETVPVKLKPGMDGPKVKQWPLTGEKIKALVEICTEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIRQLCKLLRGAKALTEVIQLTKEAE

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, V31I, V37I, A91T, L101I, S119P, V201I, I204L, S230N, L234F, A265V D25DGV
>CA124193| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMASVFNLPPIVAKEIIASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPTETGQETAYFILKLAGRWPVKTIHTDNGPN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDILATDIQTKELQKQITKIQNFRVYYRDNRDPFWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009