<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA790 CA55114 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 365
2 AZT+DDC 22
3 3TC+AZT 31
4 3TC+AZT+IDV 9
5 3TC+D4T+IDV 60
6 D4T+DDI+RTV+SQV 58
7 D4T+DDI+EFV+RTV+SQV 28
8 D4T+DDI+EFV+SQV 18
9 Unknown 292

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70KR, L74V, M184V, T215Y K219Q K101EQ, Y181C, G190S   V35I, T39A, K49R, V106VI, K122E, D123E, I135T, R172RK, V179IT, D218E, D237E, E248D, A272AP, A288AT, I293IV, E297A  
>CA55114| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEKEGKISRIGPENPYNTPV
FAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSITVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDITI
CQYVDDLYVSSDLEIGQHRTKIEELRQHLLRWGFYTPEQKHQKEPPFLWMGYELHPEKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKTLTEVVPLTAEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V L10F, L24I, L33F, G73T I13V, G16A, L19LI, L63P, I66V, I72V, P79D, I93L  
>CA55113| codons 1-99
PQITLWQRPFVTVKIAGQIKEALIDTGADDTVFEEMNLPGRWKPKIIGGIGGFVKVRQYD
QIPIEVCGHKAVTTVLVGDTPVNVIGRNLLTQLGCTLNF

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012