<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7916 CA55061 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T 57
2 3TC+D4T 9
3 3TC+AZT+IDV 65
4 3TC+D4T+NFV 174
5 3TC+AZT+NVP 210

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D L10V, E35D, M36V, L63P, A71V, I93L  
>CA55061| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADNTVLEDVNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, K70KR, M184V, T215F K219KE G190A A98G E6EK, T39AE, I94IL, K102KQ, K122E, D123E, I135L, I142V, S162A, D177E, V179I, V245T, A272P, I293V, E297A  
>CA55062| codons 1-300
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICEELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGLPHPGGLKQKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSLNNETPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPEIII
YQYVDDLYVASDLEIGQHRTKIEELRQHLLRWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTAEAE

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010