<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG320_453 453 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 None 52
3 DDI 52
4 None 210
5 AZT 8
6 AZT+ D4T 4
7 AZT 17
8 AZT+ 3TC 1
9 AZT 2

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219N Y181C V179E V35VL, T39A, E44D, D123E, I135K, S163SC, I167IV, E169ED, K173E, I178L, G196E, T200A, R211K, L228H, A272P, K277R, E297A, V317A, Y342F, R358RK, T377M, K390R, A400T, K431T, V435I, L469I, T470TN, D488X K32DE
>453| codons 1-488
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIEALLEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSPAIFQSCMTKVLDPFREQNPDLEI
CQYMDDLYVGSDLEIEQHRAKIEELRQHLWKWGFYTPDNKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTAEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQGQWTYQIFQEPFKNLKTGKYARMKGA
HTNDVKQLTEAVQKIAMESIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSINDTTNQKTELQ
AIHLALQE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12A, D60E, Q61E, L63P, V77VI  
>453| codons 1-99
PQITLWQRPLVAIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYE
EIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Hammer, SM A controlled trial of two nucleoside analogues plus indinavir in persons with human immunodeficiency virus infection and CD4 cell counts of 200 per cubic millimeter or less. AIDS Clinical Trials Group 320 Study Team. N Engl J Med, 1997