<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG320_4273 4273 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 29
2 DDI 61

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y K219KQ     I135IT, K166R, K173KE, I195IM, T200TAIV, V245M, L260LI, A272P, I293V, V317A, P345Q, K390R, A400T, V435I, A446S, H483Y T253TN
>4273| codons 1-487
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFREQNPDIVI
YQYVDDLYVGSDLEMGQHRVKIEELRQHLLRWGFYTPDQKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWNVNDIQKIVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQGQWTYQIYQEQFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGASNRETKLGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AIYLALQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T4P, Q7D, L63P, V82VI  
>4273| codons 1-99
PQIPLWDRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPINIIGRNLLTQIGCTLNF

References
Author Title Citation
Hammer, SM A controlled trial of two nucleoside analogues plus indinavir in persons with human immunodeficiency virus infection and CD4 cell counts of 200 per cubic millimeter or less. AIDS Clinical Trials Group 320 Study Team. N Engl J Med, 1997