<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG320_3611 3611 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 4
2 None 63
3 AZT 130

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, K20R, L33V, M36L, R41K, Q61H, I64IV, E65ED, V82VI, L89LM, I93ILM  
>3611| codons 1-99
PQITLWQRPLVTIKIGGQIREALLDTGADDTVVEELNLPGKWKPKMIGGIGGFIKVRQYD
HILVDICGHKAIGTVLVGPTPINIIGRNMLTQMGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, T27TP, S68SN, K102KR, G196GE, Q207T, V245T, E248DN, I293V, K311R, I326V, G333E, Q334H, R356RK, M357MI, R358RK, T377R, T386I, A400T, Y405YH, K431T, V435VA, V466A, H483Y, D488X L210ST
>3611| codons 1-488
PISPIDTVPVKLKPGMDGPKVKQWPLPEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDNTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRTHLTRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPNKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILREPVHGVYYDPSKDLVAEIQKQEHGQWTYQIYQEPFKNLKTGKYAKIKGA
HTNDVKQLTEAVQKIARESIVIWGKIPKFKLPIQKETWETWWTEHWQATWIPEWEFVNTP
PLVKLWYQLETEPIAGAETFYVDGAANRETKLGKAGYVTDRGRQKAVSLTDTTNQKTELQ
AIYLALQE

References
Author Title Citation
Hammer, SM A controlled trial of two nucleoside analogues plus indinavir in persons with human immunodeficiency virus infection and CD4 cell counts of 200 per cubic millimeter or less. AIDS Clinical Trials Group 320 Study Team. N Engl J Med, 1997