<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG320_3038 3038 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 128
2 DDI+ D4T 1
3 D4T 126
4 None 8
5 3TC+ AZT+ IDV 1

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D T215D     V60I, K122E, S162A, K277R, A288AS, I293V, E297A, D324E, I329L, R358K, G359GS, V365VI, T369TI, A376S, K390R, A400AT, S468SP A299T
>3038| codons 1-493
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFDTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKSLTEVVPLTAETE
LELAENREILKEPVHGVYYDPSKELIAELQKQGQGQWTYQIYQEPFKNLKTGKYARMKSA
HTNDIKQLIEAVQKISTESIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVPLTDTTNQKTELQ
AIHLALQDSGLEV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37S, R41K, L63P, V77I  
>3038| codons 10-99
LVTIKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVRQYDQIPIEICGH
KAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Hammer, SM A controlled trial of two nucleoside analogues plus indinavir in persons with human immunodeficiency virus infection and CD4 cell counts of 200 per cubic millimeter or less. AIDS Clinical Trials Group 320 Study Team. N Engl J Med, 1997