<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG320_2648 2648 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 189
2 AZT+ DDI 52
3 AZT+ DDC 52
4 AZT 23
5 D4T 65
6 AZT+ 3TC+ IDV 1

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y A62V, D67E     K43Q, I50IV, W88C, V118I, K122E, S162SG, N175Y, R211K, A272P, K277R, I293IV, I329V, G333E, G359S, A371V, A376T, A400T, K451KR, D460N, Q487X S68MV
>2648| codons 1-487
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQEGKISKVGPENPYNTPV
FVIKKKEVTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQGSMTKILEPFRKQYPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQEQGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEVVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETRLGKAGYVTNRGRQKVVSLTDTTNQKTELQ
AIHLALH

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, E35ED, N37NADT, L63P, V77VI  
>2648| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEDMTLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Hammer, SM A controlled trial of two nucleoside analogues plus indinavir in persons with human immunodeficiency virus infection and CD4 cell counts of 200 per cubic millimeter or less. AIDS Clinical Trials Group 320 Study Team. N Engl J Med, 1997