<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG320_2333 2333 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 72
2 None 9
3 AZT 1
4 DDI 31
5 None 16
6 DDC+ AZT 145

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, V75M, L210W, T215Y   K103KN   E40F, K43E, V118I, K122E, I142T, S162C, I195L, G196E, R211K, K223Q, E224ED, L228R, A272P, I329L, M357T, S379G, V381I, A400T, A446S, L469I  
>2333| codons 1-479
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTFLEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLELEQHRTKIEELRQHLWKWGFYTPDKKHQQDPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKIATEGIIIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGASNRETKLGKAGYVTDRGRQKVVSITDTTNQKTEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, N37S, L63LP, I64V, V77VI  
>2333| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Hammer, SM A controlled trial of two nucleoside analogues plus indinavir in persons with human immunodeficiency virus infection and CD4 cell counts of 200 per cubic millimeter or less. AIDS Clinical Trials Group 320 Study Team. N Engl J Med, 1997