<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG320_1504 1504 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 25
2 DDI 21
3 DDI+ NVP+ AZT 87
4 AZT 2

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, L210LW, T215Y   Y181C V179D K11N, I31L, D123E, I135L, E169D, T200I, R211K, L228R, V245K, Q278H, I293V, S322A, S379SG, T386I, E404ED, D488X  
>1504| codons 1-488
PISPIETVPVNLKPGMDGPKVKQWPLTEEKLKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIDI
CQYMDDLYVGSDLEIGQHRIKIEELRQHLWKWGFYTPDKKHQKEPPFRWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPAKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATEGIVIWGKIPKFKLPIQKETWEAWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AIHLALQE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R41K, L63P, I93L  
>1504| codons 7-99
QRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPIEI
CGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Hammer, SM A controlled trial of two nucleoside analogues plus indinavir in persons with human immunodeficiency virus infection and CD4 cell counts of 200 per cubic millimeter or less. AIDS Clinical Trials Group 320 Study Team. N Engl J Med, 1997