<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG320_1321 1321 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NVP NA
2 AZT 79
3 None 12
4 DDI 85
5 None 121

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V T215C Y181C A98G V35VE, T39A, K49R, I50V, R83K, K122E, A272AP, I293V, T296S, E297A, L301M, M357V, S379G, V381I, K385R, K390R, A400T, E404D, K451KR, D460N, H483HY  
>1321| codons 1-484
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALEEICAELEKEGKISRVGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKKTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFCTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLSAEAE
MELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARVRGA
HTNDVKQLTEAVQKIATEGIIIWGRTPKFRLPIQKETWETWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETRLGKAGYVTNRGRQKVVSLTDTTNQKTELQ
AIYL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63AT, I72T, V77I, L89M  
>1321| codons 13-99
IKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQITIEICGHKAT
GTVLIGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Hammer, SM A controlled trial of two nucleoside analogues plus indinavir in persons with human immunodeficiency virus infection and CD4 cell counts of 200 per cubic millimeter or less. AIDS Clinical Trials Group 320 Study Team. N Engl J Med, 1997