<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG320_113 113 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 34
2 DDI 4
3 DDI+ DDC 50
4 DDC 29
5 DDC+ AZT 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210LW, T215Y       V60I, K82KR, K102Q, K103R, V118VI, I135T, S162C, G196GE, R211K, A272P, K277R, T286TA, I293IV, E297EQ, K366R, A400T, T403M, E404D, V466A, S468P, L491P  
>113| codons 1-492
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNRRTQDFWEVQLGIPHPAGLKQRKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVVPLTQEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVRQLTEAVQKIATESIVIWGKTPKFKLPIQKETWETWWMDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKAVPLTDTTNQKTELQ
AIHLALQDSGPE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, R41K, L63P, A71T, I93L  
>113| codons 6-99
WQRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGKWKPKMIGGIGGFIKVRQYDQIPIE
ICGHKTIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Hammer, SM A controlled trial of two nucleoside analogues plus indinavir in persons with human immunodeficiency virus infection and CD4 cell counts of 200 per cubic millimeter or less. AIDS Clinical Trials Group 320 Study Team. N Engl J Med, 1997