<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
99UFRJ_9 99UFRJ_9 Brazil 1999 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ IDV 87

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46L   E21K, E34K, E35N, M36I, R41K, R57K, Q61H, L89M  
>99UFRJ_9| codons 1-99
PQITLWQRPLVTIKIGGQLKKALLDTGADNTVLKNINLPGKWKPKLIGGIGGFIKVKQYD
HILIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K122E, D123E, T200A, Q207E, R211K, V245Q, A272P, K277R, K281R, I293V, E297K, R356K, G359S, I375V, A376T, S379C, V381I, K385R, K390R, T397I, A400T, V435I, V466T, S468P, D471E, T477A, H483Q, L491S, L517I, S519N, K527Q, V531I, A534S, V559I  
>99UFRJ_9| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCRLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKMRSA
HTNDVKQLTEAVQKVTTECIIIWGRTPKFRLPIQKEIWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKTVPLTETTNQKAELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESEIVNQIIEQLIQKEKIYLSWVPAHK
GIGGNEQVDKLVSAGIRKIL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, L74I, E96D, L101I, T112V, T124A, T125A, K136Q, V201I, T218I, L234V, D256E S283G
>99UFRJ_9| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIIIVAVHVASGYIEAEVIPAETGQDTAYFILKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Thomson, MM Analysis of near full-length genome sequences of HIV type 1 BF intersubtype recombinant viruses from Brazil reveals their independent origins and their lack of relationship to CRF12_BF. ARHR, 2004