<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RES077 RES077 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT 43
2 AZT+DDI+SQV 192

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M F53L L10V, I15V, K20R, E35D, M36I, N37D, R41K, R57K, D60E, Q61N, T74S, L89M  
>RES077| codons 1-99
PQITLWQRPVVTIKVGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGLIKVKQYE
NILIEICGHKAIGSVLVGPTPVNIIGRNMMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q     E6D, K122E, D123E, E203ED, Q207QE, D218E  
>RES077| codons 1-234
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIDELREHLLRWGFFTPEQKHQKEPPFLWMGYEL

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004