<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
208 208 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 64
2 3TC+ AZT 20
3 3TC+ D4T+ NFV 67

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Y115F, Q151M V75I, F77L, F116Y, K219E     S68G, D177E  
>208| codons 36-225
EICTEMEKEGKISKIGPENPYNTPVFAIKRKDGTRWRKLIDLRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAFYSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKG
SPAIFQSSMTKILEPFRKQNPEIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFT
TPDEKHQKEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46I N88D L10I, N37S, R41K, L63P, K70R, V77I  
>208| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADNTVLEEMSLPGKWKPKIIGGIGGFIKVRQYD
QIPIEICGHRAIGTVLIGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004