<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RES075 RES075 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 52
2 3TC+D4T+SQV 143
3 3TC+D4T+NFV 9
4 3TC+AZT+EFV+NFV 65
5 APV+D4T+DDI+RTV 48
6 Unknown 4

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV   L10V, I13V, I15V, K20T, E35D, M36I, R41K, R57K, D60E, Q61D, I62V, L63LP, T74TA, V82I, I85V, L89M, I93IL  
>RES075| codons 1-99
PQITLWQRPVVTVKVGGQLTEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVKQYE
DVPIEICGHKAIGAVLVGPTPINIVGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103KN P225PH K20R, V35I, E53ED, D123E, I135T, S162F, D177E, F214FL, A272P, V292I, E297K, Q334L  
>RES075| codons 1-335
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTEMEKEGKISKIGPDNPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQFSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEHPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEIIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGLG

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004