<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
205 205 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 4
2 AZT+DDI 8
3 3TC+AZT 127
4 D4T+DDI+NFV 117

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, G16E, K20R, M36I, N37K, P39S, R41N, H69K, I93L  
>205| codons 1-99
PQITLWQRPLVTIRVEGQLREALLDTGADDTVLEEIKLSGNWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39D, K43R, S48T, V60I, K122E, D123G, E138A, I142V, K173Q, R211K, V245Q, A272P, E291D, V292I, I293V, G335D, R356K, G359T, K366R, T377Q, K390R, E404D, V435A, L452M, V466I, S468T, D471E, H483Q, L484I, L491S, S519N, K530R, A534S, A554N  
>205| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEREGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNATPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRQQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVRQLTEAVQKIAQESIVIWGKTPKFRLPIQKETWEAWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAANRETKMGKAGYVTDRGRQKIVTLTETTNQKTELQ
AIQIALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKERVYLSWVPAHK
GIGGNEQVDKLVSNGIRKVL

References
Author Title Citation
Santos, AF Characterization of a new circulating recombinant form comprising HIV-1 subtypes C and B in southern Brazil. AIDS, 2006
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004