<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
202 202 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 90
2 AZT+ DDI+ RTV 8
3 AZT+ DDI 51
4 3TC+ AZT+ RTV 3
5 3TC+ RTV 1
6 3TC+ D4T+ RTV 2
7 3TC+ D4T+ NFV+ NVP 143

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E Y181C V108I T69N, L109V, I135T, S162Y, V189I, I202V, R211K, D218E  
>202| codons 36-225
EICTEMEKEGKISKIGPENPYNTPVFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTIVDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SPAIFQYSMTKILEPFRKQNPDIVICQYVDDLYIGSDLEIGQHRTKVEELRQHLLKWGFF
TPEEKHQKEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10I, N37S, L63P, A71V, V77I  
>202| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKVIGTVLIGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004