<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
276 276 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 106
2 3TC+ AZT 32
3 3TC+ AZT+ NVP 12
4 3TC+ D4T+ NVP 23

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y   K101E, Y181C, G190A   K43Q, E44D, A98S, K122E, D123N, I135T, E138A, I202V, H208Y, R211K, H221Y  
>276| codons 36-225
EICTELEQDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIP
HPSGLEKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKG
SPAIFQSSMTKILEPFRKQNPDIVICQYVDDLYVASDLEIGQHRTKVEELRQYLWKWGFY
TPDKKYQKEP

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004