<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
274 274 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 74
2 3TC+ AZT 10
3 3TC+ AZT+ RTV 37
4 3TC+ D4T+ NVP+ RTV+ SQV 125
5 3TC+ D4T+ EFV+ NFV 68

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184V, L210W, T215Y K219N Y181C, G190A   T39A, E44D, K102Q, V118I, K122E, R125K, I135T, I142V, S162C, D177E, V179I, T200A, E203K, H208Y, R211K, K223E  
>274| codons 36-225
EICAELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIP
HPAGLKQKKSVTVLDVGDAYFSIPLDEDFKKYTAFTIPSTNNETPGVRYQYNVLPQGWKG
SPAIFQCSMTKILEPFRKQNPEIIICQYVDDLYVASDLEIGQHRAKIKELRQYLWKWGFY
TPDNKHQEEP

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004