<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
273 273 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 54
2 3TC+ AZT 8
3 3TC+ AZT+ RTV 4
4 3TC+ D4T+ RTV 173

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y V75A     E44D, V118I, K122E, R211A, K223Q  
>273| codons 36-225
EICTELEKDGKISKIGPENPYNTPVFAIKKKDSTKWRKIADFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKG
SPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLWAWGFY
TPDKKHQQEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82A, I84V L24I, L33F L10I, I13V, E34Q, I62V, L63A, V77I  
>273| codons 1-99
PQITLWQRPIVTVKIGGQLKEALIDTGADDTVFQEMNLPGRWKPKLIGGIGGFIKVRQYD
QVAIEICGHKAIGTVLIGPTPANVIGRNLLTQIGCTLNF

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004