<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RG018 RG018 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+RTV 4
2 3TC+AZT+RTV 4
3 3TC+AZT+SQV 39
4 3TC+D4T+IDV 48
5 3TC+D4T+NFV+NVP 31
6 3TC+D4T+IDV+NVP+RTV 44
7 3TC+AZT+IDV+RTV 82
8 Unknown 2

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82VA   L10I, T12N, I15V, K20R, E35D, M36I, N37T, R41K, K45R, I54X, R57K, Q61N, I62V, L63C, A71AV, T74S, L89IM, I93L  
>RG018| codons 1-99
PQITLWQRPIVNIKVGGQLREALLDTGADDTVLEDITLPGKWKPRMIGGIGGFXKVKQYD
NVCIEICGHKVIGSVLVGPTPANIIGRNILTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70KR, L74LI, M184MV K219Q     E6D, K20R, A33AG, V35I, V106VI, K122E, I135T, I142M, S162Y, K173T, Q174K, N175NY, T200A, I202IV, E203K, Q207E, R211A, F214L, D218DE, V245Q, E248D, A272P, T286A, E291ED, I293V, P294S, E297T, L325F, G333R, Q334H  
>RG018| codons 1-335
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKGLIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGMRYQYNVLPQGWKGSPAIFQYSMTKILEPFRTKYPDIVI
YQYVDDLYVGSDLEIGQHRAKVKELREHLLAWGLTTPEQKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDVVSLTTEAE
LELAENREILKEPVHGVYYDPSKDFIAEIQKQRHG

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004