<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
197 197 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 46
2 3TC+ D4T 60
3 3TC+ D4T+ RTV+ SQV 65

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184V A62V, V75I, F77L, F116Y, K219Q   E138K K49R, I50V, S68G, K101Q, R172K, V179A, I202V, F214L  
>197| codons 36-225
EICTEMEKEGKISRVGPENPYNTPVFVIKKKDGTKWRKLIDLRELNKRTQDFWEVQLGIP
HPAGLQKKKSVTVLDVGDAYYSVPLDKDFRKYTAFTIPSINNKTPGIRYQYNVLPMGWKG
SPAIFQSSMTKILEPFKKQNPDIAIYQYVDDLYVGSDLEIGQHRTKVEELRQHLLRWGLT
TPDQKHQKEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37S, L63C, I64V, V77I  
>197| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QICVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004