<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
268 268 Brazil 2002 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 AZT 34
2 None 39
3 AZT 98
4 DDI+ AZT 55
5 3TC+ AZT 22
6 3TC+ SQV+ AZT 14
7 3TC+ D4T+ RTV 90
8 3TC+ D4T+ NFV+ NVP 135

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K55R, L63P, V77I, T91I, I93L  
>268| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIRVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLIQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E40D, K49R, I50V, V60I, Q174L, D177E, I178V, Q207E  
>268| codons 36-225
EICTDMEKEGKISRVGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKG
SPAIFQSSMTKILEPFRKLNPEVVIYQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFT
TPDKKHQKEP

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004