<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RG008 RG008 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 83
2 D4T+DDI+EFV 18
3 3TC+AZT+IDV+RTV 52
4 Unknown 3

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, K20R, E35D, M36I, N37D, R41K, H69Q, L89M, I93L  
>RG008| codons 1-99
PQITLWQRPLVTIKVGGQIREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGQKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E Y181C A98G V35T, T39G, K49R, I135V, S162C, E169D, K173A, Q174K, D177E, G196E, T200A, Q207E, R211K, V245Q, P247A, E248D, A272P, K277R, T286A, E291D, V292I, I293V, P294T, E297A, S322T, I329L  
>RG008| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICGEMEKEGKISRIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPEIVI
CQYVDDLYVGSDLEIEQHRAKIEELREHLLKWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIQLADKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVTLTAEAE
LELAENREILKEPVHGVYYDPTKDLIAELQKQGQG

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004