<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
252 252 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 23
2 3TC+ AZT+ RTV 12
3 3TC+ D4T+ RTV 21
4 3TC+ D4T+ NFV 14
5 3TC+ D4T+ NFV+ NVP 174

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S, L90M   L10I, L19I, N37S, K45R, L63P, A71T, V77I, I93L  
>252| codons 1-99
PQITLWQRPIVTIKIGGQIKEALLDTGADDTVLEEMSLPGRWKPRMIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLIGPTPVNIIGRSLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215I, K219E K101E, Y181C, G190A   E44D, V118I, K122E, I135T, T200I, F214L  
>252| codons 36-225
EICTEMEKDGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLEKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SPAIFQSSMTKILEPFRKQNPDIVICQYVDDLYVASDLEIGQHRIKIEELRQHLLRWGLI
TPDEKHQKEP

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004