<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RG070 RG070 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT 100
2 AZT+DDI 22
3 3TC+AZT 35
4 3TC+AZT+IDV 126
5 3TC+AZT+IDV+RTV 52
6 Unknown 76

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82S L24I, F53FL, Q58E L10I, K20R, E35D, M36I, R41K, K55R, R57K, Q61N, I62IV, L63P, A71V, L89M, I93L  
>RG070| codons 1-99
PQITLWQRPIVTIKIGGQLREALIDTGADDTVLEDINLPGKWKPKIIGGIGGLVRVKEYD
NVPIEICGHKVIGTVLVGPTPSNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, L210W, T215Y V75M, K219Q     P4S, K20KR, V35VI, T39A, K43KN, E44D, D123E, S162Y, K173T, Q174K, T200A, Q207A, H208Y, R211K, W212C, D218E, L228H, V245Q, E248D, A272P, Q278H, T286A, V292VI, I293V, P294T, E297A  
>RG070| codons 1-335
PISSIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICAELENDGKISKIGPENPYNTPV
FAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRTKNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRAYLWKCGFYTPEQKHQKEPPFHWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKHLCKLLRGAKALTEIVTLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004