<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F131 F131 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV+RTV 9
2 3TC+AZT+EFV 61
3 Unknown NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M   Q7H, L10I, I15V, G16E, K20R, E35D, M36I, P39S, R41K, K55E, R57K, D60E, Q61D, K70R, I72V, T74A  
>F131| codons 1-99
PQITLWHRPIVTIKVEGQLREALLDTGADDTVLEDINLSGKWKPKIIGGIGGFVEVKQYE
DILIEICGHRAVGAVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004