<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
246 246 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 20
2 AZT+ DDI 43
3 3TC+ AZT 62
4 AZT+ DDI 77
5 3TC+ D4T+ NFV 132

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, K14R, G17D, L63P, A71T, I72T, N98K  
>246| codons 1-99
PQITLWQRPVVTIRIGDQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTTGTVLVGPTPVNIIGRNLLTQIGCTLKF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V K219Q     V118I, K122E, I135T, I178V, F214L  
>246| codons 36-225
EICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SPAIFQSSMTKILEPFRKQNPDVVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLT
TPDQKHQKEP

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004