<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
171 171 Brazil 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 150
2 AZT+ DDI 81
3 3TC+ AZT+ RTV 143
4 3TC+ D4T+ EFV 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A Q58E L10I, T12Q, I15V, G16E, L19I, E34Q, N37S, P39S, L63P  
>171| codons 1-99
PQITLWQRPIVQIKVEGQIKEALLDTGADDTVLQEMSLSGRWKPKMIGGIGGFVKVREYD
QIPIEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, V75M, M184V, T215Y K219E K103N   T39A, K122E, I135T, D177E, I178V, I202V  
>171| codons 36-225
EICAELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIP
HPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SPAIFQSSMTKILEPFRKQNPEVVIYQYVDDLYVGSDLEIGQHRTKVEELRQHLLRWGFY
TPDEKHQKEP

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004