<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
164 164 Brazil 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 48
2 3TC+ AZT 44
3 3TC+ D4T+ RTV 154

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82L F53L L10V, T12S, G16A, K20R, E35D, M36I, N37D, I64V, H69K, K70E, V77I, T91S  
>164| codons 1-99
PQITLWQRPVVSIKIAGQLREALLDTGADDTVLEDIDLPGRWKPKIIGGIGGLIKVRQYD
QILVEICGKEAIGTVLIGPTPLNIIGRNLLSQIGCTLNF

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004