<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
237 237 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 7
2 3TC+AZT 50
3 3TC+AZT+RTV+SQV 9
4 3TC+AZT+NFV+SQV 115
5 3TC+AZT+RTV+SQV 13
6 AZT+DDI 31

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, L210W, T215Y     A98G K43N, E44D, K82R, K122E, D123E, I167V, D177E, H208Y, R211K, D218E  
>237| codons 36-225
EICTELENDGKISKIGPENPYNTPVFAIKKKNSTKWRKLMDFRELNRRTQDFWEVQLGIP
HPGGLKKKKSVTVLDVGDAYFSVPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKG
SPAIFQSSMTKVLEPFRKQNPEIVIYQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFY
TPEKKHQKEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, N37S, R41K, D60E, L63P, I93L  
>237| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVRQYE
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004