<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
159 159 Brazil 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 99
2 3TC+ AZT+ NVP 14

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   K103N, G190A   K43Q, E44D, K122P, I135T, D177E, H208Y, R211K  
>159| codons 36-225
EICTELEQDGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKNKSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SPAIFQSSMTKILEPFRKQNPEIVIYQYMDDLYVASDLEIGQHRTKIEELRQYLLKWGFY
TPDKKHQKEP

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004