<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
226 226 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 44
2 3TC+D4T+NFV 1
3 3TC+D4T+RTV 64

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82S L33F, K43T I13V, D60E, L63P, I64V, V77I  
>226| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVFEEMNLPGRWTPKMIGGIGGFVKVRQYE
QIPVEICGHKAIGTVLIGPTPSNIIGRNLLTQIGCTLNF

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004