<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RES093 RES093 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 26
2 AZT+DDI+RTV 26
3 AZT+DDI+IDV+RTV 26
4 3TC+AZT+EFV 39
5 3TC+AZT+IDV+RTV 9
6 Unknown 3

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82AT, L90M F53L L10IV, K14R, I15V, G17D, L19I, K20R, E35D, M36I, R41K, D60E, Q61N, L63T, A71V, I72T, T74A, L89M, I93L  
>RES093| codons 1-99
PQITLWQRPIVTIRVGDQIREALLDTGADDTVLEDINLPGKWKPKMIGGIGGLVKVRQYE
NITIEICGHKVTGAVLVGPTPANIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, L210W, T215Y   K103N A98G, V108I K20KR, V35T, E44D, V118I, K122E, I135L, S162F, E169D, K173A, Q174K, T200A, E203K, Q207E, R211Q, K223E, V245Q, E248D  
>RES093| codons 1-251
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTELEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQFSMTKILDPFRAKNPDIVI
YQYVDDLYVGSDLEIGQHRAKIKELREHLWQWGFYTPDKKHQEEPPFLWMGYELHPDKWT
VQPIQLPDKDS

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004