<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
223 223 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 66
2 3TC+AZT+NFV 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, E35D, R41K, K70R, V77I  
>223| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEDMNLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGHRAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184I, L210W T215C Y181V   E44D, V118I, D123E, I135V, S162C, K173A, Q174K, N175Y, V179I, T200A, E203K, Q207E, H208Y, R211K  
>223| codons 36-225
EICTELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKG
SPAIFQCSMTKILEPFRAKYPDIIIVQYIDDLYVGSDLEIGQHRAKIKELREYLWKWGFC
TPDKKHQKEP

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004