<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RG046 RG046 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+RTV 8
2 3TC+AZT+NFV 100
3 3TC+D4T+NFV 81

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V, T215Y D67DE     V35T, T39TA, K43Q, S68SG, V118VI, K122KE, I135V, S162X, E169D, K173A, Q174K, I178L, Q207A, H208Y, R211K, P243S, A272P, K277R, T286A, E291D, V292I, I293V, E297A  
>RG046| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELEQEGKISKIGPENPYNTPV
FAIKKKEGTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQXSMTKILDPFRAKNPDLVI
YQYVDDLYVGSDLEIGQHRTKIEELRAYLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQSIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, I54V, L90M   L10V, I15IV, K20R, E35D, M36V, N37E, R57K, D60E, Q61DN, I62V, L63LP, A71V, I72T, V77I, I93L  
>RG046| codons 1-99
PQITLWQRPVVTIKVGGQLREALLDTGADDTVLEDVELPGRWKPKLIGGIGGFVKVKQYE
DVPIEICGHKVTGTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004