<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RES40 RES40 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 96
2 3TC+D4T+NFV 17
3 3TC+D4T+RTV 17
4 D4T+DDI+EFV 65
5 Unknown 2

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12M, I15V, E35D, M36I, R57K, D60E, Q61D, L63T, G68E, H69R, I72T  
>RES40| codons 1-99
PQITLWQRPLVMIKVGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYE
DITIEICERKATGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N K219Q K101KE, K103N K238T I135V, E138A, S162C, E169D, K173T, Q174K, D185X, T200A, I202V, Q207E, F214L, V245Q D186DN
>RES40| codons 1-252
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRTKNPDIVI
YQYMXNLYVGSDLEIGQHRAKVEELREHLLRWGLTTPDQKHQKEPPFLWMGYELHPDTWT
VQPIQLPEKDSW

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004