<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
219 219 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 23
2 AZT+ DDI 24
3 3TC+ AZT 44
4 3TC+ AZT+ D4T 58
5 3TC+ AZT+ D4T+ NVP 47
6 3TC+ AZT+ D4T+ NFV+ RTV 124

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K70T, K219R Y181C, G190A   T39A, E40F, K43E, K101Q, L109I, V118I, K122E, D123X, I135T, D177E, E194A, G196E, T200A, H208Y, R211K, D218E  
>219| codons 36-225
EICAFLEEEGKISKIGPENPYNTPVFAIKKKNSTTWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLQKKKSVTVIDVGDAYFSIPLDEXFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SPAIFQSSMTKILEPFRKQNPEIVICQYMDDLYVASDLAIEQHRAKIEELRQYLWKWGFY
TPERKHQKEP

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004