<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
215 215 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 17
2 None 50
3 3TC+ D4T 26
4 3TC+ D4T+ NFV+ NVP 95
5 3TC+ D4T+ RTV+ SQV 47
6 3TC+ ABC+ APV+ D4T 17

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184V K70T K103N, Y181C   S68G, D123E, I135T, G196E, T200A, F214L, H221Y  
>215| codons 36-225
EICTEMEKEGKISKIGPENPYNTPVFAIKRKDGTTWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SPAIFQSSMTKILEPFRKQNPDIVICQYVDDLYVGSDLEIEQHRAKIEELRQHLLRWGLT
TPDKKYQKEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, I84V, L90M L10F N37T, L63P, H69K, A71V  
>215| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEEMTLPGRWKPKMIGGIGGFLKVRQYD
QIPIEICGKKVIGTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Dumans, AT Synonymous genetic polymorphisms within Brazilian human immunodeficiency virus Type 1 subtypes may influence mutational routes to drug resistance. J Infect Dis, 2004