<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG364_903 903 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 250
2 AZT+DDC 278

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V       I31L, V35I, R83RG, K122E, I135T, I142IN, S162Y, I178M, S251I Q85QP, N136NS, Y144YC
>903| codons 1-291
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKGTPDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTSNETPGNRCQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDIWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, L63P, V77I, V82I, I93L  
>903| codons 1-99
PQITLWQRPLVSIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPINIIGRNLLTQLGCTLNF

References
Author Title Citation
Albrecht, MA Nelfinavir, efavirenz, or both after the failure of nucleoside treatment of HIV infection.AIDS Clinical Trials Group 364 Study Team. N Engl J Med, 2001