<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG364_8 8 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 195
2 AZT+DDI+3TC 92

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V, T215F D67G, K219Q     K20R, V35IM, K43Q, K64N, K102Q, K104KN, I135L, S162H, T200A, Q207QH, D218E, L228LH, V245K, A272P, T286A  
>8| codons 1-302
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTEMEQEGKISKIGPENPYNTPV
FAINKKGSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKNSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRHHLLRWGFFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTEEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12N, K14R, G16E, R41K, I62V, L63Q  
>8| codons 1-99
PQITLWQRPLVNIRIEGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QVQIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Albrecht, MA Nelfinavir, efavirenz, or both after the failure of nucleoside treatment of HIV infection.AIDS Clinical Trials Group 364 Study Team. N Engl J Med, 2001