<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG364_777 777 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 227
2 AZT+DDI 182
3 AZT+3TC 94

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, T69D, K70R, M184V, T215FV D67G, K219Q     K20KR, S48T, K64H, V118I, I135T, E138EQ, F214L, D218DE, L228H, A272AS, Q278H, A288T, T290TS K259K*
>777| codons 1-292
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKITKIGPENPYNTPV
FAIHKKGSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNQTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLVTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQ*LVGKLNWASQIYSGIKVKHLCKLLRGTKTLSEV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T4TA, I13IL, N37S, I64IV, V77I  
>777| codons 1-99
PQIALWQRPLVTLKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Albrecht, MA Nelfinavir, efavirenz, or both after the failure of nucleoside treatment of HIV infection.AIDS Clinical Trials Group 364 Study Team. N Engl J Med, 2001