<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG364_752 752 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 202
2 AZT+DDC 201
3 AZT+DDC+3TC 89

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215*Y K219K*R     E28EG, E44ED, V60I, V118I, K122E, D123DG, I135IV, E169D, K173KN, V179VG, I202V, Q207E, R211K, V245M D177DV, K201KN
>752| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTGEKIKALVEICTELEKDGKISKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEGFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRNQNPVIGI
YQYVDDLYVGSDLEIGQHRTNVEELREHLWKWGFYTPDRKHQKEPPFLWMGYELHPDKWT
VQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15IV R8R*
>752| codons 1-99
PQITLWQ*PLVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Albrecht, MA Nelfinavir, efavirenz, or both after the failure of nucleoside treatment of HIV infection.AIDS Clinical Trials Group 364 Study Team. N Engl J Med, 2001