<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG364_6608 6608 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 137
2 AZT+DDI 190
3 AZT+DDI+3TC 89

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184MV, L210W, T215Y     A98AG V21I, V35L, T39A, E40F, K43E, V106VI, V118I, D121H, K122E, A158S, S162A, I178LM, E203D, H208Y, R211K, V245KR, A272P  
>6608| codons 1-302
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALLEICAFLEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHPGGLKKKKSITVLDVGDAYFSIPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQASMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRTKIDELRQYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIRLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37S, L63P, V77VI I3IHLN
>6608| codons 1-99
PQNTLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMSLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Albrecht, MA Nelfinavir, efavirenz, or both after the failure of nucleoside treatment of HIV infection.AIDS Clinical Trials Group 364 Study Team. N Engl J Med, 2001