<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG364_6013 6013 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 269

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219KQ     K20KR, I50V, K101R, K104N, I202IV, V245R, A272P, K277R, I293V  
>6013| codons 1-299
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKVGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLRKKNSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELRQHLLRWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIRLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEA

References
Author Title Citation
Albrecht, MA Nelfinavir, efavirenz, or both after the failure of nucleoside treatment of HIV infection.AIDS Clinical Trials Group 364 Study Team. N Engl J Med, 2001